Protein Info for Ac3H11_1681 in Acidovorax sp. GW101-3H11

Annotation: Similar to cobalamin biosynthesis protein CbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details PF03186: CobD_Cbib" amino acids 39 to 267 (229 residues), 98.5 bits, see alignment E=4.2e-32 PF17113: AmpE" amino acids 63 to 234 (172 residues), 23.1 bits, see alignment E=4.5e-09

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 88% identity to vei:Veis_0320)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.10

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KBX6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Ac3H11_1681 Similar to cobalamin biosynthesis protein CbiB (Acidovorax sp. GW101-3H11)
MSFFAILFALLIEQARPLARSNPIHAGLRAWALSVSRNFDAGKPHHGWVAWCLAVLLPAL
ITLAIHWALLWGLGWPFAVLWSVAVLYVTLGFRQFSHHFTGIRDALEEGDEDAARERLAH
WQQVDVGALPRSEIVRHVIEYSVLAAHRHVFGVLAWFSVLAALGLGPTGAVLYRLAEFVS
RYWQYRQRAGTQPASASLQKACAQAWTVVDWLPARLTALSFAVVGSFEEAIEGWRFHAQR
FPNDNDGVVLAATAGAINVRLGGEALKSRTEMQAPQGLEIDADMGDSDATPGREPEVGHL
RSVVGLVWRSVVVWMLLLALLTLARLLG