Protein Info for Ac3H11_1482 in Acidovorax sp. GW101-3H11

Annotation: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02311: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
  • amino acids 7 to 254 (248 residues), 384.8 bits, E=8.6e-120
• PF03328: HpcH_HpaI
  • amino acids 19 to 244 (226 residues), 194.4 bits, E=8.6e-62

Best Hits

Swiss-Prot: 63% identical to HPCH_KLEP7: 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (hpcH) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 67% identity to bav:BAV1261)

MetaCyc: 62% identical to 4-hydroxy-2-ketopimelate aldolase monomer (Escherichia coli C)
4-HYDROXY-2-KETOPIMELATE-LYSIS-RXN [EC: 4.1.2.52]

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

MetaCyc Pathways

• 4-hydroxyphenylacetate degradation (6/8 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Lysine degradation
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-, 4.1.2.n4

Use Curated BLAST to search for 4.1.2.- or 4.1.2.52 or 4.1.2.n4

Sequence Analysis Tools

See A0A165KE74 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Ac3H11_1482 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4) (Acidovorax sp. GW101-3H11)
MMQIPNNRFRNALREGQPQIGLWVGLADANAAEALAGCGFDWLLLDGEHAPNDVRSVLDQ
LRAVAPYPAHPVVRPVQADVALVKQYLDVGAQTLLIPMVDTPEQAALMVRAMRYAPEGIR
GMGAALARASRWNQVEDYLNCANGEMCLLVQAETPLAMQNLQAIAATDGVDGVFFGPADL
SASMGYRGQASHPAVQRAILEGIATVRAVGKAPGILMADRQLAQSYLDAGALFVAVGVDT
TLLVRSATELARSFGRNSAPVPTRVPLAGGGNPY