Protein Info for Ac3H11_1391 in Acidovorax sp. GW101-3H11

Annotation: Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR02622: CDP-glucose 4,6-dehydratase" amino acids 7 to 351 (345 residues), 453.5 bits, see alignment E=2.5e-140 PF04321: RmlD_sub_bind" amino acids 12 to 175 (164 residues), 27.4 bits, see alignment E=3.6e-10 PF01370: Epimerase" amino acids 13 to 247 (235 residues), 95.2 bits, see alignment E=8.7e-31 PF16363: GDP_Man_Dehyd" amino acids 14 to 325 (312 residues), 101.8 bits, see alignment E=1.1e-32 PF02719: Polysacc_synt_2" amino acids 65 to 198 (134 residues), 26.6 bits, see alignment E=6.9e-10

Best Hits

KEGG orthology group: K01709, CDP-glucose 4,6-dehydratase [EC: 4.2.1.45] (inferred from 77% identity to vei:Veis_4419)

Predicted SEED Role

"Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)" (EC 4.2.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K0R3 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Ac3H11_1391 Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45) (Acidovorax sp. GW101-3H11)
MRPDPDFWRGKRVLLTGHTGFKGAWLALWLQRLGAQVTGVALPPATGPNLFTLAQLGQGG
PGIESHFCDIRSPQALAMRVRAARPEVVLHLAAQALVRPGYAAPLDTFATNVMGTAHVLD
ALRGLPEARVALVVTTDKVYRNREWAYPYREDDPLGGHDPYSASKAATELVTASYRDSFL
AAQGVAVATARAGNVIGGGDWAQDRLLPDAVRAWEKGETLHIRRPRATRPWQHVLEPLAA
YLRLAQRLWETPALAGAYNFGPLPHEAATVKNVIELASAAYPASAISYENESDGPHEAGW
LALETAHARQVLGVAPHWSLNTAVARTMNWYRQQHGGADARALCLADIDAWEARP