Protein Info for Ac3H11_1381 in Acidovorax sp. GW101-3H11

Annotation: RNA polymerase sigma factor for flagellar operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 10 to 235 (226 residues), 109.9 bits, see alignment E=9.7e-36 PF04542: Sigma70_r2" amino acids 13 to 85 (73 residues), 62.4 bits, see alignment E=5.5e-21 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 13 to 236 (224 residues), 284 bits, see alignment E=9.3e-89 PF04539: Sigma70_r3" amino acids 96 to 168 (73 residues), 37.8 bits, see alignment E=3.3e-13 PF08281: Sigma70_r4_2" amino acids 181 to 226 (46 residues), 31 bits, see alignment 3.2e-11 PF04545: Sigma70_r4" amino acids 184 to 233 (50 residues), 58.1 bits, see alignment 1e-19

Best Hits

Swiss-Prot: 40% identical to FLIA_PSEAE: RNA polymerase sigma factor FliA (fliA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 86% identity to vei:Veis_0929)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JZG1 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Ac3H11_1381 RNA polymerase sigma factor for flagellar operon (Acidovorax sp. GW101-3H11)
MYTAKGQLDRDAMIRQHVPLVRRIAHHMIAKLPPNVELDDLIQVGMMGLAEALSRYEVAQ
GVQFETFATQRIRGAMLDELREGDWMSRSSRKSQKDIEHAVHRLEQKLGRSPLESEIASE
MGMSLPDYQNLLGKVRGTQLVYLEDMTHGNDDEDGFLDRHVADADADPVELLRDQRLKTS
LVNAIKSLPEREQHIMGMYYEHDMNLKEIAAVLGVTESRVCQLHSQSIARLRAKMRAH