Protein Info for Ac3H11_1177 in Acidovorax sp. GW101-3H11

Annotation: TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details PF04290: DctQ" amino acids 23 to 150 (128 residues), 57.5 bits, see alignment E=6.8e-20

Best Hits

KEGG orthology group: None (inferred from 63% identity to pol:Bpro_2123)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LAQ5 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Ac3H11_1177 TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 3 (Acidovorax sp. GW101-3H11)
LKFLSFLAQACAVLAGIILTGVTLITCASLIGRNTTGWTLLGDYELTAVAAGAAIALFMP
WCQLRRQNIIVDFFTARASSAVNARLDRFGALLLAAMFIVLAWRTAAGGLSARSSMTTTM
MLGFPEWITYAAMVPPLLLTGVIALVQVFGPAQKEEEGVA