Protein Info for Ac3H11_1039 in Acidovorax sp. GW101-3H11

Annotation: Phosphoserine phosphatase (EC 3.1.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00338: phosphoserine phosphatase SerB" amino acids 45 to 258 (214 residues), 221.9 bits, see alignment E=7.7e-70 PF00702: Hydrolase" amino acids 47 to 227 (181 residues), 73.2 bits, see alignment E=7.5e-24 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 49 to 224 (176 residues), 103.6 bits, see alignment E=1.2e-33 PF06888: Put_Phosphatase" amino acids 49 to 220 (172 residues), 30 bits, see alignment E=7e-11 PF12710: HAD" amino acids 50 to 223 (174 residues), 81.4 bits, see alignment E=2.5e-26 PF08282: Hydrolase_3" amino acids 189 to 246 (58 residues), 39.1 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 75% identical to SERB_POLSJ: Phosphoserine phosphatase (serB) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 88% identity to aaa:Acav_1623)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JV10 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Ac3H11_1039 Phosphoserine phosphatase (EC 3.1.3.3) (Acidovorax sp. GW101-3H11)
MKRGDTIAGSVLPPTKHPAACAMTHATEFAPGLVVQGITPPLSLSAYKLIAFDMDSTLIN
IECVDEIADAAGRKAEVAAITEAAMQGVITDYKESLRQRVALLKGVTVQHMEQVFTERLR
FNPGAQELITAAKAAGLTTLLVSGGFTFFADRVKAGLGIDFARSNMLEVQDGQLTGRMVD
QAWGDICDGAEKRRTLLEVASLMGISPQQAIAVGDGANDLPMMGAAGLSVAYHAKPTVRA
QAKVAINQGGLDRLLEVLR