Protein Info for Ac3H11_1003 in Acidovorax sp. GW101-3H11

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13416: SBP_bac_8" amino acids 42 to 336 (295 residues), 69.3 bits, see alignment E=4.7e-23 PF13343: SBP_bac_6" amino acids 157 to 343 (187 residues), 28 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 94% identity to pol:Bpro_1010)

Predicted SEED Role

"ABC transporter substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JU67 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Ac3H11_1003 ABC transporter substrate-binding protein (Acidovorax sp. GW101-3H11)
VARRSLLKGTAGILAAGVFPAVHSQEKIVLRYLGTAVNQDKAIAEKFKADTGIEIQYVAV
TTDDVTKRAVTAPNSFDLIDTEYFSLKKIVPTGNLKGIDTKRIKNADKITTLFTTGQVAG
KAVGDQGTAPKKVIYLEGEKSKKFATAPTQFMSLIPTVYNADTLGIRPDLIKRPINSWAE
LLNPEFKGKTAILNIPSIGIMDAAMVVEALGLYKYPDKGNMTKKEIDLTIKTLIEAKKQG
QFRALWKDFNESVNLMASGEVVIQSMWSPAVTAVRTKGIACNFQPLKEGYRAWAAGFGLP
ATLSGRKLDGAYEFINWFLDGWAGAYLNRQGYYSAVLDTAKSKMEAYEWAYWMEGKPATQ
DIKSPNGDVLAKAGAVRDGGSYESRMGGIACWNALMDENNYMVQKWNEFVAA