Protein Info for Ac3H11_1000 in Acidovorax sp. GW101-3H11

Annotation: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF02277: DBI_PRT" amino acids 17 to 351 (335 residues), 402.9 bits, see alignment E=5.8e-125 TIGR03160: nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase" amino acids 17 to 351 (335 residues), 414.1 bits, see alignment E=2.3e-128

Best Hits

Swiss-Prot: 55% identical to COBT_AZOSB: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (cobT) from Azoarcus sp. (strain BH72)

KEGG orthology group: K00768, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC: 2.4.2.21] (inferred from 80% identity to ajs:Ajs_3176)

Predicted SEED Role

"Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.4.2.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JU52 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Ac3H11_1000 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21) (Acidovorax sp. GW101-3H11)
MQSLAAFNVPAIADISDAPLTARLQHLLDNKTKPLGSLGRLEALALRIGQVLGTEAPALL
LPQMLVCAGDHGLAAKGVSAFPSDVTWQMVENFLAGGAAVSVLARQHGLQLTVVDCGVAR
PIAQRETAPGAPRLLVHKVAPGTADASVGPAMTAEQCAQAIANGMEVVRGLPGNALLLGE
MGIGNTSVASLLLARLAGLPLAEVTGAGTGLDAAGIERKRAVLQQALDANADAATPLAAL
AALGGYEVATLVGAVLQAAAERRVIVVDGFITSAAVLVASRLQPAVLQRCVFAHRSGERG
HTLMLAQMQAEPLLDLGLRLGEGSGAALAWPLLQSACAVLAEMASFESAGVATQTA