Protein Info for AZOBR_RS32300 in Azospirillum brasilense Sp245

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 30 to 253 (224 residues), 71.1 bits, E=1.8e-23
• PF12146: Hydrolase_4
  • amino acids 31 to 249 (219 residues), 43 bits, E=5.1e-15
• PF12697: Abhydrolase_6
  • amino acids 31 to 258 (228 residues), 79.9 bits, E=6.8e-26

Best Hits

Swiss-Prot: 63% identical to NICD_PSEPK: N-formylmaleamate deformylase (nicD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 69% identity to reh:H16_A0924)

MetaCyc: 64% identical to N-formylmaleamate deformylase (Alcaligenes faecalis)
RXN-11318 [EC: 3.5.1.106]

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

MetaCyc Pathways

• nicotinate degradation I (4/6 steps found)
• picolinate degradation (4/7 steps found)
• nicotine degradation III (VPP pathway) (6/10 steps found)
• nicotine degradation II (pyrrolidine pathway) (5/11 steps found)
• superpathway of nicotinate degradation (5/18 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.106

Sequence Analysis Tools

See G8B0I6 at UniProt or InterPro

Protein Sequence (269 amino acids)

>AZOBR_RS32300 alpha/beta hydrolase (Azospirillum brasilense Sp245)
MTSSTHRYGANVRGNGIRQHYLRYGGEGRPVVIVPGITSPAVTWGFVAERFGRNFDTYVL
DVRGRGLSEASDALDYGLDAMAADVTAFAEALGLRDYALVGHSMGARIGLRAVSRHGAAP
ARLVMVDPPVSGPGRRPYPAQLPWYVDSIRLMREGADLEAMRPFCPTWTDAQLRLRAEWL
HTCDERAIVTAFNDFQTDDIHADFPRIPCPALLIAAGRGDVIRPEEEAEIRRLQPELAVT
RVEGAGHMIPWDDEEGFYRAFGTFLGTAV