Protein Info for AZOBR_RS32275 in Azospirillum brasilense Sp245

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 275 (268 residues), 116.7 bits, see alignment E=5.5e-38

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 72% identity to bxe:Bxe_C0220)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8B0I1 at UniProt or InterPro

Protein Sequence (290 amino acids)

>AZOBR_RS32275 branched-chain amino acid ABC transporter permease (Azospirillum brasilense Sp245)
MDLFPQFLANGLVMGVFYALSALGLTLIFGLMRVVNFAHGEFYMLGGVSGWFVTNYLGLD
FFSGLIVVAAFMAAVGWLVDRFLIERVRGQGEEPGILLTIGLSIFLVNGTLLLVGPAPMK
VAGAVAEGPLFFGPIAVTKLRLLAVAVGIALIVGAHLLIRRTRLGAAMRATFQDPMAASL
AGIRTGHVYAATFALGCTLAALSGMLLASIYSAQASVGGLISLKSFVVVILGGMGSFAGA
IAGGLLLGVAEAMWGGYVSMGMVDVIGFVLVILILLFRPQGLFSIRTERA