Protein Info for AZOBR_RS31390 in Azospirillum brasilense Sp245

Annotation: 3-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR01832: 2-deoxy-D-gluconate 3-dehydrogenase" amino acids 5 to 252 (248 residues), 392.5 bits, see alignment E=3.9e-122 PF00106: adh_short" amino acids 10 to 202 (193 residues), 181.4 bits, see alignment E=2.1e-57 PF08659: KR" amino acids 11 to 185 (175 residues), 40.5 bits, see alignment E=4.3e-14 PF13561: adh_short_C2" amino acids 19 to 249 (231 residues), 193.8 bits, see alignment E=5.3e-61

Best Hits

Swiss-Prot: 62% identical to KDUD_ECOLI: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (kduD) from Escherichia coli (strain K12)

KEGG orthology group: K00065, 2-deoxy-D-gluconate 3-dehydrogenase [EC: 1.1.1.125] (inferred from 77% identity to azl:AZL_d01440)

MetaCyc: 62% identical to putative 2-keto-3-deoxy-D-gluconate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]; 1.1.1.- [EC: 1.1.1.127]; RXN0-7101 [EC: 1.1.1.127]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AZX6 at UniProt or InterPro

Protein Sequence (252 amino acids)

>AZOBR_RS31390 3-ketoacyl-ACP reductase (Azospirillum brasilense Sp245)
MTNPFDLTGKTALVTGGNGGIGQAIAVALARAGADIAVAGRTPPDETRALVEGLGRRFAA
IPADLSSIAPIPALMEETVGTLGGLDILVNNAGLIRRDDPLDFTEADWDAVLDVNLKSVF
FLCQAFGRYALGNGRKGKIINIASMLSFQGGIRVPSYAASKSGIAGITRLLANEWAGKGI
NVNAIAPGYVATSVTTALRADERRNAEILARIPAGRWSEPADMGGPAVFLASDASDYVHG
TILPVDGGWLAR