Protein Info for AZOBR_RS28140 in Azospirillum brasilense Sp245

Annotation: cytochrome P450

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 221 to 243 (23 residues), see Phobius details PF00067: p450" amino acids 27 to 357 (331 residues), 81.6 bits, see alignment E=2.7e-27

Best Hits

KEGG orthology group: K00517, [EC: 1.14.-.-] (inferred from 69% identity to azo:azo2527)

Predicted SEED Role

"putative cytochrome P450 hydroxylase" in subsystem Nitric oxide synthase

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AXX6 at UniProt or InterPro

Protein Sequence (387 amino acids)

>AZOBR_RS28140 cytochrome P450 (Azospirillum brasilense Sp245)
MFRFDPYSPAVDADPFPFYKTLRDEHPCFWSEEANMWVLSRYDDIVTALNDWETYSSAKG
NLMDEMPNRAGNTLGTTDPPRHDRLRSIVQFAFTKKAVEGLTEPVRASANRALDAVQGER
TFDFVSDVSSKVTVDVLFGLFNLPRENERMVRDKAVLMVQSDPRTRQKGPEHLAAFQWMS
EYAKELVELRKREPGDDLITALIQAEVAGEKLADREVQMTITTLIMAGIESLSGFLAMFA
LNLADHADARRRLAANPALIPDAIEESLRFNTSAQRFRRCLQKDVELHGQTMRAGDFVCL
AYGSGNRDERRFANAHLYDIDRKPKGHLGFGGGVHACLGTAFARLAARVACEEFLKRVPE
FVRVQDQLPWMPSTTFRSPTRLELAVG