Protein Info for AZOBR_RS28130 in Azospirillum brasilense Sp245

Annotation: pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 PF07992: Pyr_redox_2" amino acids 14 to 310 (297 residues), 224.2 bits, see alignment E=7.3e-70 PF00070: Pyr_redox" amino acids 155 to 235 (81 residues), 59.8 bits, see alignment E=9.4e-20 PF13450: NAD_binding_8" amino acids 158 to 194 (37 residues), 22.8 bits, see alignment 2.8e-08 PF14759: Reductase_C" amino acids 329 to 413 (85 residues), 115.3 bits, see alignment E=4.7e-37

Best Hits

Swiss-Prot: 46% identical to THCD_RHOER: Rhodocoxin reductase (thcD) from Rhodococcus erythropolis

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 62% identity to azo:azo2529)

MetaCyc: 42% identical to carbazole 1,9a-dioxygenase ferredoxin reductase component (Sphingomonas sp. XLDN2-5)
RXN-11511 [EC: 1.14.12.22]

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.22 or 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AXX4 at UniProt or InterPro

Protein Sequence (417 amino acids)

>AZOBR_RS28130 pyridine nucleotide-disulfide oxidoreductase (Azospirillum brasilense Sp245)
MGGPAQAEPADGGMVIVGAGQGGLQVAESLRAEGYDGPITLIGEEASAPYHRPPLSKAIL
AGTMEEAQLAIRGAEFFERQRIALLTGTRVAAIDRSARHVRLEDGRRLEYRGLALATGAR
VRRLPVAGDELDGVLGLRSLDDARRIRVALDRAARVVVIGGGYIGLEVAAAARKRGLEVT
ILEAADRLLARSATPFLAAFYADLHRSQGALVELGAKVVALDGQGGRVTAVRTADGRSHP
ADLVVVGVGIVPDTALAEGCGLACDGGILVDDSARTDDPAIVAVGDCTARRTGTGTPLRL
ESVQNAVEQGRSAAAALLGRERPFTAAPWFWSDQYDVKLQIVGLSADHDRMVLRGSPEDR
RFSAFYFRRDALVAIDSINRPADHMAGRKLLDHKTMITPEQAADESLPLASLMRPGR