Protein Info for AZOBR_RS26090 in Azospirillum brasilense Sp245

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF01596: Methyltransf_3" amino acids 20 to 219 (200 residues), 240.3 bits, see alignment E=1.9e-75 PF13847: Methyltransf_31" amino acids 63 to 176 (114 residues), 30.4 bits, see alignment E=4.6e-11 PF13578: Methyltransf_24" amino acids 65 to 171 (107 residues), 56.8 bits, see alignment E=5.6e-19

Best Hits

Swiss-Prot: 44% identical to CMTD1_HUMAN: Catechol O-methyltransferase domain-containing protein 1 (COMTD1) from Homo sapiens

KEGG orthology group: None (inferred from 59% identity to rce:RC1_1081)

MetaCyc: 51% identical to (R)-2-hydroxymalonyl-[acp] 2-O-methyltransferase (Streptomyces hygroscopicus ascomyceticus)
2.1.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AWE5 at UniProt or InterPro

Protein Sequence (220 amino acids)

>AZOBR_RS26090 SAM-dependent methyltransferase (Azospirillum brasilense Sp245)
LTVQSIFMPEAIYRYMLDASLRETAIQAKLRAETAKLTEAHYQIAPEEGQLLAFLVEMIG
ARRTLDIGTFTGYSALTVAQSLPDDGRVISFDVNEQWTSQARAIWSEAGVADKIDLRIGP
ALDSLDKLLDDREGESFDFAFIDADKENYDAYYERCLSLVRRGGLIVVDNTLWRGRVADP
SDRKHKTQAIRVFNAARLEDERVALCMLPVGDGVTLLRRR