Protein Info for AZOBR_RS26065 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 PF13432: TPR_16" amino acids 44 to 100 (57 residues), 18 bits, see alignment 1.6e-06 amino acids 111 to 173 (63 residues), 21.3 bits, see alignment E=1.5e-07 PF04055: Radical_SAM" amino acids 293 to 430 (138 residues), 76 bits, see alignment E=1.8e-24 PF13353: Fer4_12" amino acids 295 to 406 (112 residues), 29.2 bits, see alignment E=4.9e-10 PF13186: SPASM" amino acids 500 to 568 (69 residues), 55.9 bits, see alignment E=2e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AWD8 at UniProt or InterPro

Protein Sequence (590 amino acids)

>AZOBR_RS26065 hypothetical protein (Azospirillum brasilense Sp245)
MQDLSLSFRQAVALHQQGRLPEANAAYRAVLDAMPDHADTLRLWGLVALQSGAAGAACAR
LSCAVAANPGSAEALHVLGGAFRQTGDLGKALDSYRRATVLRPVFPECHFNHGNALIQAE
RPLEAAVAYRMAVVQQPLAANSRLNLAGVLNRIGDPAGAALQARAAVALEPHQPAMLTAL
GRAETGLGNAVAAERTHGRAHRLDPRQEPLAYEHGLALSAIGRIEEAGVLLHALARSTDA
SVRLGAKLALHRLVLRCIDVDDYRRAAAVTMNGWSGQGSHGAAMLPMRVRLESSSACNLR
CRHCTTGVAYHSTERRLLKPELFERILQDLKGIEALVSCVMYLGGEPLMNPQLERMIRRL
RDETSIDQIHFVTNAMLVTEERCRELADSGVARIIVSIDGRSPEENDAIRRGSHYPTVRQ
NLNLMRRYLEPAGVQLDISNNILRRPGDPPTAATPAFLIRDFPGLSIATNYAYKWPGWTQ
TEEEAALAVEVNPGRRRGFCGAPFTETVIRPNGDVTLCCYDISGIEVMGNLRQGSLEEIW
NGERYRAVRLAMMAGDEAALPGVCRNCPVYTGEEIQERPANLPVPGVAAV