Protein Info for AZOBR_RS26055 in Azospirillum brasilense Sp245

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details PF05992: SbmA_BacA" amino acids 34 to 343 (310 residues), 69.2 bits, see alignment E=4.5e-23 PF06472: ABC_membrane_2" amino acids 35 to 303 (269 residues), 118 bits, see alignment E=5.4e-38

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 68% identity to azl:AZL_e01420)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AWD6 at UniProt or InterPro

Protein Sequence (599 amino acids)

>AZOBR_RS26055 ABC transporter (Azospirillum brasilense Sp245)
MSIASRTPDRSGFTRRFLHLAGGFWSGGARSDGRNWMVWLLAGALGLLTVGQVVVPILLN
LWSQHLFDALEQRSMDRFVLMIAAAGGIILFNIVNTILHLRVKRRLQLGWRTWLTQKLLG
DWLTRGRQHQVTYLPGDHDNPDGRIAEDIRIATEAAIDLALSLSYCALLLISFTNILWRL
SGSPEVTLAGSTVHVPGYLLYIALVYAAVGTSIALLMGKPLVRAVNRRQGHEASFRFGLA
RVRENAQDVALLHGESGERDRLGVLFGGVQRGWNGQTHALSNMMVFSAAYSVLSAVFPIL
VASPSYIAGAISLGVLMQTAQAFQQTVGALSWPIDNLARAAEWKASVERVLGLHEALQRL
DREIDGQGTERITVERSDGEHCLSFRGLSIAEPDGRRVVEPFDLEIRPGERVLIVGDPAA
AVRLFRAVARVWPWGGGGIVLPALTRVFFMAERPYLPHDTLRAALSYPLGAETVGDAAAA
AALDRVGLGHLRARLDESDSWDEVLAVSEQQLLGFARLLIRRPDWIFLEDATDSLDPRTE
EAMLRLIDSEFPAATLITIGSHPGLEAHHRRKLVLERCDDTVRMREEPRGDRRIAAVAE