Protein Info for AZOBR_RS26000 in Azospirillum brasilense Sp245

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 PF00989: PAS" amino acids 5 to 73 (69 residues), 29.7 bits, see alignment E=2.2e-10 amino acids 135 to 241 (107 residues), 48.6 bits, see alignment E=3.1e-16 TIGR00229: PAS domain S-box protein" amino acids 7 to 127 (121 residues), 34.4 bits, see alignment E=1.1e-12 amino acids 131 to 251 (121 residues), 75.8 bits, see alignment E=1.6e-25 PF08448: PAS_4" amino acids 8 to 120 (113 residues), 35.6 bits, see alignment E=3.9e-12 amino acids 141 to 246 (106 residues), 37.9 bits, see alignment E=7.5e-13 amino acids 269 to 382 (114 residues), 34.5 bits, see alignment E=8.7e-12 PF13426: PAS_9" amino acids 13 to 120 (108 residues), 22.5 bits, see alignment E=4.7e-08 amino acids 144 to 243 (100 residues), 49.7 bits, see alignment E=1.5e-16 PF13188: PAS_8" amino acids 134 to 185 (52 residues), 29.4 bits, see alignment 2.2e-10 PF07536: HWE_HK" amino acids 403 to 457 (55 residues), 30.5 bits, see alignment 2e-10 PF07568: HisKA_2" amino acids 403 to 476 (74 residues), 80.5 bits, see alignment E=3.1e-26 PF13581: HATPase_c_2" amino acids 490 to 571 (82 residues), 29.2 bits, see alignment E=3.3e-10 PF02518: HATPase_c" amino acids 502 to 592 (91 residues), 36.2 bits, see alignment E=2.9e-12

Best Hits

KEGG orthology group: None (inferred from 68% identity to azl:AZL_e02320)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AWC0 at UniProt or InterPro

Protein Sequence (609 amino acids)

>AZOBR_RS26000 histidine kinase (Azospirillum brasilense Sp245)
MPWLDGLLDAMDAGIVVLDRHGRVQFWNRWMERASGTTEPDIHGRELVEALPSLRDTRLH
NAVRDVLETGAPSVLSHTLNPVLFPLRCPDGRRMVHNVLIRPFTVANASYCLIQVTDVTA
VVNRERVLREQRDARYRAIVDTAPDAIVTTDTRGVVQWANGAAALQFGFPPNELIGQHVS
LFLAEGSPDWSGLLERDPAGRPAPVELIGRKRDGTRIDLEVSLARWESEGRSFITGVLRD
ITERRRTREELKANALAMRQLAEQTKATLDALPAHIAVLDHGGHIISVNKAWAGSGPQAG
FLGDGSAIGDDYLEACAATRSGAEHADALIEGLRGLLRGGAPVSIEYPGLSDAGPRWYRC
LAAPMAAGPFGGAVLMHIDVTEIKSMEAALRKLVGQKSTLLREVNHRVKNSLQLVSSLLT
LQTMSLPGAAERVHFQDARSRIDAIARVHSRLYQTEQFQTIEFGSYLNELCTDLSRASGG
DTLGSIEVRAERVDLPIDQAAPLGLIANELITNAIKHRGSTPANVLVSLDRAGDLLALTV
TDQGPGLPAAFDMRRSRSLGMRLITSLTGQVGATVTLMPVERGTSFRIALTMPETRGPIL
EDSAAEWNG