Protein Info for AZOBR_RS25470 in Azospirillum brasilense Sp245

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 224 to 251 (28 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 6 to 277 (272 residues), 135.8 bits, see alignment E=8.2e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 58% identity to adk:Alide2_1527)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AVZ9 at UniProt or InterPro

Protein Sequence (297 amino acids)

>AZOBR_RS25470 ABC transporter permease (Azospirillum brasilense Sp245)
LVAQQIVNGIVVGSTYALFALGFTLIFGVLHVLNLAHGAVFMWGAFTGLFAVTALGLPLP
AAFAVAMLAAGLLSVLVDAVAFRPLRRRGSPEFAAIISSLGVAQILMSAAQIASNTQVQR
FPFGTFPIVFYQVFGLRVSLQQIVIVGSVAVLVAALLAFLFATSFGRQIRAVAISERTAS
LLGVNPGAVHALTFFLCGALAGAAGVIIGIAFNSVHFLMGEPYLLRGFVVIVLGGLGSVA
GAVVGGLLFGMIQTLSVAFLSSALSDAILFGLLFVILLLRPSGFFGTLRREIRVVRQ