Protein Info for AZOBR_RS23550 in Azospirillum brasilense Sp245
Annotation: tetrathionate reductase subunit B
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to TTRB_SALTY: Tetrathionate reductase subunit B (ttrB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K08358, tetrathionate reductase subunit B (inferred from 70% identity to mag:amb3289)MetaCyc: 64% identical to tetrathionate reductase beta subunit (Salmonella enterica enterica serovar Typhimurium)
1.21.99.M4 [EC: 1.21.99.M4]
Predicted SEED Role
"Tetrathionate reductase subunit B" in subsystem Tetrathionate respiration
MetaCyc Pathways
- tetrathionate reduction I (to thiosulfate) (1/1 steps found)
- superpathway of tetrathionate reduction (Salmonella typhimurium) (1/4 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.21.99.M4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8AUM9 at UniProt or InterPro
Protein Sequence (250 amino acids)
>AZOBR_RS23550 tetrathionate reductase subunit B (Azospirillum brasilense Sp245) MDRSRRNFCLGAGAATIGAATVAAMPAAAAPSAAPLRRDGNPAHRWAMVVDVRKCVGCQA CTVACIMENDVPENSFRTIVSTYEVTEQGKAGSYMLPRLCNHCEDPPCIPVCPTGATFQR RDGIVVVDNTVCVGCAYCVQACPYDARFINHETQTADKCTFCVHRVEAGLLPACVETCVG GARIFGDLNDPDSAVATLVREENPKVLKPEQGTQPRVFYLGLDPRFQGKVDGTPTLWRPS RETHAQKEHA