Protein Info for AZOBR_RS23200 in Azospirillum brasilense Sp245

Annotation: carbohydrate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR00196: YjeF family C-terminal domain" amino acids 23 to 292 (270 residues), 167.1 bits, see alignment E=2.6e-53 PF01256: Carb_kinase" amino acids 32 to 288 (257 residues), 155.7 bits, see alignment E=1.5e-49 PF08543: Phos_pyr_kin" amino acids 139 to 257 (119 residues), 27.6 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 57% identity to met:M446_0742)

Predicted SEED Role

"NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AUF1 at UniProt or InterPro

Protein Sequence (297 amino acids)

>AZOBR_RS23200 carbohydrate kinase (Azospirillum brasilense Sp245)
MNDSIPVTRDLLRSMPLPHPGDSADKDGRGRVLVIGGSVEVPGAVLLAGTAALRAGAGKL
QMATCRSVAPHLGLAVPEALVLGLHETAEGGIAPDCVDTLCERAARCTAVLIGPGMMDKL
AVADLTGALIAGLDGEGGPVLVIDAEALMGLDNANEALCRRGGRTIITPHAGEMAGLSGV
SREEVEADPPTAARRVADLHKVIVVLKGACTHIATPDGRIWAYDGGNVGLATSGSGDTLA
GVIAGLAARGADPAQAAIWGVHLHGEAGNRLARRGPLGFLARELLAQVPEIMAELSA