Protein Info for AZOBR_RS23155 in Azospirillum brasilense Sp245

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details PF02518: HATPase_c" amino acids 314 to 414 (101 residues), 64.6 bits, see alignment E=5.5e-22

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 76% identity to azl:AZL_e01280)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AUE1 at UniProt or InterPro

Protein Sequence (424 amino acids)

>AZOBR_RS23155 histidine kinase (Azospirillum brasilense Sp245)
VRDTTDKKNLFLLVQLRWLAVAGQVVTILIVHYQMGITLPLDQMGAVILFLVALNIASVL
HLRRQTSVSNTQLFLELLIDVSALTVQLYLSGGASNPFISLYLLQITLGAVLLEAWSAWA
LVLVATACFTFLIGAYRPLALPPGLEGLLLGLHIQGMFLCFVLTASLIVPFITQITRNLR
ARDAHLADLRQRSMEEDHIVRLGLLASGAAHELGTPLATLSVIVNDWRRMPVVKGDPDMA
EDIAEMQNQINRCKAIVSGILLSSGEARGEGTLRTTVTAFLDDLVAEWKDSRSPACVDYD
NSVRSREGIISDLALKQVIFNVLDNALEVSPGWVGIAAGRQGDSLVLTVNDAGPGFEERM
LAEFGKPYRSSKGRPGGGLGLFLVVNVVRKLGGSVAARNRPSGGASVTMTLPLAALSAGE
SHGD