Protein Info for AZOBR_RS20490 in Azospirillum brasilense Sp245

Annotation: cyclohexadienyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02826: 2-Hacid_dh_C
  • amino acids 15 to 83 (69 residues), 26.3 bits, E=1.3e-09
• PF03807: F420_oxidored
  • amino acids 15 to 105 (91 residues), 44.9 bits, E=4.4e-15
• PF03446: NAD_binding_2
  • amino acids 15 to 139 (125 residues), 33.2 bits, E=1.6e-11
• PF01210: NAD_Gly3P_dh_N
  • amino acids 16 to 103 (88 residues), 24.7 bits, E=6.2e-09
• PF02153: PDH_N
  • amino acids 28 to 182 (155 residues), 130.8 bits, E=9.3e-42
• PF20463: PDH_C
  • amino acids 185 to 285 (101 residues), 104.2 bits, E=1.3e-33

Best Hits

Swiss-Prot: 42% identical to TYRC_ZYMMO: Cyclohexadienyl dehydrogenase (tyrC) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00220, cyclohexadieny/prephenate dehydrogenase [EC: 1.3.1.12 1.3.1.43] (inferred from 87% identity to azl:AZL_d00870)

Predicted SEED Role

"Cyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• 4-hydroxy-3-prenylbenzoate biosynthesis (3/4 steps found)
• L-tyrosine biosynthesis III (2/4 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• superpathway of novobiocin biosynthesis (6/19 steps found)

KEGG Metabolic Maps

• Novobiocin biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

See G8ANW8 at UniProt or InterPro

Protein Sequence (301 amino acids)

>AZOBR_RS20490 cyclohexadienyl dehydrogenase (Azospirillum brasilense Sp245)
MSETAAPLAAPLFDRVAIVGVGLIGSSLARALTHYGVARQVVCADRSPEHCAKAMELGIV
ERATTDLAEALEGADLVVLATPVGAFAEVGEQLGPLLRPGMIVTDVGSVKQAVLRDVGPH
IPDGVHLIPGHPVAGTEHSGPEAGFATLFQGRWCIVTPPPGANEGAVDKVVTMWRRIGST
VELMDANHHDRVLAITSHLPHLIAYTIVGTASDLEDDTKSEVIKFSAGGFRDFTRIAASD
PVMWRDVFLNNREAVLEILQRFTEDLTALQRAIRWGEGEQLQDHFTKTRAIRRGIIDAKQ
A