Protein Info for AZOBR_RS20470 in Azospirillum brasilense Sp245

Annotation: methionine biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02081: methionine biosynthesis protein MetW
  • amino acids 2 to 195 (194 residues), 252.3 bits, E=1.3e-79
• PF07021: MetW
  • amino acids 2 to 195 (194 residues), 266.1 bits, E=5.1e-83
• PF13489: Methyltransf_23
  • amino acids 8 to 160 (153 residues), 42 bits, E=2.5e-14
• PF13847: Methyltransf_31
  • amino acids 14 to 104 (91 residues), 38.2 bits, E=3.6e-13
• PF13649: Methyltransf_25
  • amino acids 18 to 102 (85 residues), 37.6 bits, E=8.9e-13
• PF08242: Methyltransf_12
  • amino acids 19 to 101 (83 residues), 33.3 bits, E=2e-11
• PF08241: Methyltransf_11
  • amino acids 19 to 103 (85 residues), 40.5 bits, E=1.1e-13

Best Hits

KEGG orthology group: None (inferred from 82% identity to azl:AZL_a03890)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis III (3/4 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

See G8ANW4 at UniProt or InterPro

Protein Sequence (198 amino acids)

>AZOBR_RS20470 methionine biosynthesis protein (Azospirillum brasilense Sp245)
IRTDLKLIAEMVEPGSRVLDVGCGDGALLAFLSRQKGVDARGIELSMDGVHQCVAQGLSV
IQGDAETDLKDYPPGAFDYVILSQTLQAMREPRTVLETMTRIGRRAIVSVPNFGYWRIRV
QLLLTGRMPVTEKLGYQWWETPNIHFCTIKDFVVLAEEMGIRIERCMIVDRAGRVTGHAH
SGLANLLGEQGVFLLRRD