Protein Info for AZOBR_RS20455 in Azospirillum brasilense Sp245

Annotation: methyltransferase type 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08241: Methyltransf_11
  • amino acids 81 to 129 (49 residues), 29.5 bits, 4.9e-11

Best Hits

Swiss-Prot: 45% identical to YAT4_RHOBL: ATP synthase subunits region ORF 4 from Rhodobacter blasticus

KEGG orthology group: None (inferred from 84% identity to azl:AZL_e02490)

Predicted SEED Role

"SAM-dependent methyltransferase 2, in cluster with Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions (EC 3.1.2.6)

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• methylglyoxal degradation I (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

See G8ANW1 at UniProt or InterPro

Protein Sequence (258 amino acids)

>AZOBR_RS20455 methyltransferase type 11 (Azospirillum brasilense Sp245)
MYTDIVDLREFYESGLGQAARRMIRRRIRTIWPDLRGQIVLGVGYTTPYLQPFRDEAERV
FSIMPATQGVTFWPPGGPGLVALGDEADLPLADMSVDRVLLVHGLEGTEQLRPMMREIWR
VLAGGGRVLVVVPNRRGLWARADWTPFGHGFPYSASQLKQVLRDTMFVPERTGHALFLPP
LRSRFLMKTAPAWEEVGCRWFKAFAGVTMIEASKQIFAGVSRKTQQPAKRRLIVPLPGGA
APARRPAGSGAWRVSEEP