Protein Info for AZOBR_RS20450 in Azospirillum brasilense Sp245

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 3 to 253 (251 residues), 349.3 bits, see alignment E=5.5e-109 PF00753: Lactamase_B" amino acids 13 to 169 (157 residues), 87.2 bits, see alignment E=1.4e-28 PF16123: HAGH_C" amino acids 170 to 253 (84 residues), 105.8 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 56% identical to GLO2_METCA: Hydroxyacylglutathione hydrolase (gloB) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 68% identity to azl:AZL_e02480)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANW0 at UniProt or InterPro

Protein Sequence (253 amino acids)

>AZOBR_RS20450 hydroxyacylglutathione hydrolase (Azospirillum brasilense Sp245)
MDIHLIPAFADNYIYLLRDPASGAVGVVDPGDAQPVLAELERRNWTLTHIFNTHHHNDHI
GGNHALKARYGADVIGPRADVARIPDMETCLGEGETISFGSLAAQVFFVPGHTSGHIAFW
FTEAKALFCGDTLFALGCGRLFEGTPAQMWASLVKLRGLPDDTRVYCGHEYTLSNARFAV
TVEPDNAALKARAADIAAQRERGEPTIPSTLGVEKATNPFLRADVPEVQSALGMAGADPV
AVFAEIRGRKDRF