Protein Info for AZOBR_RS20430 in Azospirillum brasilense Sp245

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details PF00892: EamA" amino acids 144 to 277 (134 residues), 34 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 51% identity to bms:BR0706)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANV7 at UniProt or InterPro

Protein Sequence (282 amino acids)

>AZOBR_RS20430 membrane protein (Azospirillum brasilense Sp245)
LPTEALLAVLAGALLHAGWNTALKAGGGSASDAVLVVAGSAFIALLLLPVVPAPSLASAP
YLCVTAVLHVAYFRLLAAAYREGAMSHAYPLMRGTPPLLVALCSGVLLGEGLSAGAWMGT
LLVCGGILGLTLLGRRSAPSGSWRGTACALANALVIAAYTVVDGIGVRLSGSAAGYTLWG
FLLLSVPMVGGSLLSDARGFLSHARRRWMVALAGGAASIASYGLALWAMTLAPIAVVAAL
RETSILFAMALAALVLKERVGPVRLASGAVIVLGAASLRLAA