Protein Info for AZOBR_RS20195 in Azospirillum brasilense Sp245

Annotation: aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF00155: Aminotran_1_2" amino acids 10 to 362 (353 residues), 201.7 bits, see alignment E=3.2e-63 PF00266: Aminotran_5" amino acids 66 to 180 (115 residues), 24.1 bits, see alignment E=2.5e-09 PF01041: DegT_DnrJ_EryC1" amino acids 71 to 147 (77 residues), 20.7 bits, see alignment E=3.3e-08

Best Hits

Swiss-Prot: 39% identical to YBDL_ECOLI: Methionine aminotransferase (ybdL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to azl:AZL_c00430)

MetaCyc: 44% identical to 2-oxo-4-methylthiobutanoate-glutamine aminotransferase monomer (Solanum lycopersicum)
RXN-15650 [EC: 2.6.1.117]

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1 or 2.6.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANQ1 at UniProt or InterPro

Protein Sequence (369 amino acids)

>AZOBR_RS20195 aminotransferase (Azospirillum brasilense Sp245)
MSRLSDEHKAINLGQGFPDERGPADVLDVAAKAILEGWNQYPPMMGTPDLRQALAAHGRR
FYGLDIDWKTEVLVTSGATEALTASLLGLIEPGDEVVLFQPMYDSYLPIVRLAGGVPRFV
SLKAPDWSFTRADLEAAFSPKTKLVLINDPLNPAAKVFSRAELELLAEFVQRFDAFAVCD
EVYEHIVFDGRQHIPLMTLPGMRDRCLKIGSAGKTFSLTGWKVGYVTGAPHLLQPVAKAH
QYITFTTPPNLQTAVAYGLGKDDAYFAGLSSGLQAKRDRLADGLRAVGFEVLPSAGTYFV
VADVSPFGFDGNDEAFCRRLTAEAGVTAIPVGAFFVQDAPRSFIRFCFSKRDEILDGAVE
RLRAYFTRK