Protein Info for AZOBR_RS19475 in Azospirillum brasilense Sp245

Annotation: methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF00005: ABC_tran" amino acids 23 to 171 (149 residues), 129.5 bits, see alignment E=2.2e-41 PF09383: NIL" amino acids 270 to 341 (72 residues), 80 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 59% identical to METN1_RHOPA: Methionine import ATP-binding protein MetN 1 (metN1) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 84% identity to azl:AZL_d03560)

MetaCyc: 55% identical to L-methionine/D-methionine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ATF4 at UniProt or InterPro

Protein Sequence (354 amino acids)

>AZOBR_RS19475 methionine ABC transporter ATP-binding protein (Azospirillum brasilense Sp245)
MITFEQLQKTYPSRGTGQPVQALADIDLTIGRGEIYGIIGRSGAGKSTLLRTVNLLEKPT
SGRVLVDGVDVTALSARELREARHSIGMIFQHFNLLSSRTVFDNVALPLELAGVAKAQIR
ATVEPLLDLVGLTDKRDRYPAELSGGQKQRVGIARALASKPKVLLSDEATSALDPETTTQ
ILHLLADINKRLGLTIVLITHEIAVIKEICHKVAVMENGRIIEQGPVFDIFAHPKHETTK
TFVDPVINRGIPDSLRARLSATPVPGSNMVLRITFTGERATSPVISAISRKLNLDLNIWH
GQIDEIQGAPFGTLVVEAIGNPQSIEAAISLLNVNKLGVEVLGHAVPGNLRAAV