Protein Info for AZOBR_RS18400 in Azospirillum brasilense Sp245

Annotation: glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 199 to 216 (18 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF00072: Response_reg" amino acids 1 to 104 (104 residues), 66.2 bits, see alignment E=2.9e-22 PF01339: CheB_methylest" amino acids 173 to 346 (174 residues), 178.5 bits, see alignment E=1e-56

Best Hits

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 54% identity to mrd:Mrad2831_2187)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ASR0 at UniProt or InterPro

Protein Sequence (357 amino acids)

>AZOBR_RS18400 glutamate methylesterase (Azospirillum brasilense Sp245)
LVVEDSPVVQQLLAHVIGEDPRLELAGIAASGEQALRMVVSLKPDVVSLDIRLPGIDGFA
VTERLMREHPVPIVVVASDVRDLDIPMRALQAGALAVVEKPGSMARADYQTVARHLCTQL
TIMSQVKVIRQRGRPRNGDEEPVGTNGRRRGASVPMPPPLPPSVVKRQFRALGITASTGG
PAALVKLLRGLPTNFPLPVFVVQHIGAPFVAGFASWLGSVTPLPVALASDGPHRPGHVYV
APGELHLTAEPGGMRLVHGDPVCGQRPSGDVLFSSLASAFGAAAIGVLLTGMGEDGARGL
TAMHRAGAYTIAEHASTAVIHSMPGTAVRLGGVTEELPIDKVAARLLELVSTGVEPS