Protein Info for AZOBR_RS17775 in Azospirillum brasilense Sp245

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00226: DnaJ" amino acids 3 to 65 (63 residues), 90.5 bits, see alignment E=5.8e-30 PF01556: DnaJ_C" amino acids 140 to 283 (144 residues), 149.7 bits, see alignment E=6.6e-48

Best Hits

KEGG orthology group: None (inferred from 53% identity to sme:SMa0116)

Predicted SEED Role

"DnaJ-class molecular chaperone CbpA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ASB0 at UniProt or InterPro

Protein Sequence (315 amino acids)

>AZOBR_RS17775 molecular chaperone DnaJ (Azospirillum brasilense Sp245)
VEDPYEVLGVKRDASDDGIRRAYRKLAKKFHPDLNPGNSQAEERFKAVSSAYELLSDPDK
RGRYDRGEIDASGAEQRPDYSYYRDFAEGRNGSKYYGGDEEQTDDFSDLFANLFGGRFRT
RATDGGAGPEIRLRGADRRYLLTVDLLDAINGTTQRLQLPDGKTLDVAIPPGIEDGKVLR
LKGQGDPGLGGGPPGDALIEVRVTSHPLFKRVGNDLHVEVPVTLSEAVLGGSITIPTRTG
PVTMTVPAGSDTGRVLRLRGKGVPAGRGGRPAGDQYVTLKVEVGPGADDAELKDFLRSWA
PKHPFDPRRKLGMTP