Protein Info for AZOBR_RS16930 in Azospirillum brasilense Sp245

Annotation: thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF08534: Redoxin" amino acids 61 to 180 (120 residues), 59.2 bits, see alignment E=8.6e-20 PF00578: AhpC-TSA" amino acids 61 to 171 (111 residues), 56.1 bits, see alignment E=7.3e-19 PF13905: Thioredoxin_8" amino acids 82 to 172 (91 residues), 43.5 bits, see alignment E=6.9e-15

Best Hits

KEGG orthology group: None (inferred from 62% identity to azl:AZL_d01150)

Predicted SEED Role

"Thiol:disulfide oxidoreductase TlpA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ARQ8 at UniProt or InterPro

Protein Sequence (215 amino acids)

>AZOBR_RS16930 thiol:disulfide interchange protein (Azospirillum brasilense Sp245)
MRTLAATAIFCVTLGGAGLWMALAGPSAPPPPAVLTLDQPSPGATAVGLDKFRYMEPLTP
VPELPFLDGEGRRVDLSEFKDRLVLLNLWATWCAPCVKEMPALDRLQAQLGGPGFQVVAL
SVDRGGKDQVQPFYQRTGVKNLALYLDPSSVSMQTLKLRGLPTTLLVDQEGRELGRIEGA
VEWDSPEVIAFLRKHMGHGGGPNRDSRGGVVKTGG