Protein Info for AZOBR_RS16865 in Azospirillum brasilense Sp245

Annotation: DNA-(Apurinic or apyrimidinic site) lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00730: HhH-GPD" amino acids 52 to 186 (135 residues), 71.1 bits, see alignment E=4.7e-24

Best Hits

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 54% identity to sti:Sthe_1233)

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ARP3 at UniProt or InterPro

Protein Sequence (230 amino acids)

>AZOBR_RS16865 DNA-(Apurinic or apyrimidinic site) lyase (Azospirillum brasilense Sp245)
MPLRSAPPLADKDPFDIDEAFRRLRQAVAGRPKAAMFALRDRGYASPFEQLVGSLISART
RDETTIVVCERLFAVARTPQQMVALTPAELTRLLDGATFPEPKARDIRALSRRIITEHDG
EVPDTPDALMAFHGVGPKIAALTLAVGFGIPAVAVDVHVHRIVNRWGFVAAPTPERTMVA
LMELLPRHYWVEINERLVPFGKWICTGDRPRCSTCAMLSMCRQVGVTTHR