Protein Info for AZOBR_RS15495 in Azospirillum brasilense Sp245

Annotation: ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF00005: ABC_tran" amino acids 21 to 165 (145 residues), 119.5 bits, see alignment E=2.7e-38 PF08402: TOBE_2" amino acids 272 to 354 (83 residues), 24.8 bits, see alignment E=2.9e-09

Best Hits

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 57% identity to csa:Csal_0550)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.30

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AQT1 at UniProt or InterPro

Protein Sequence (360 amino acids)

>AZOBR_RS15495 ABC transporter ATPase (Azospirillum brasilense Sp245)
ITMEALALNGVTHRYGRVVAVDDVSVTIGAGEIVCLCGPSGCGKSSLLRIAAGLEAVQTG
SVRIGGTVVADERGAVPPERRGVGLVFQDYALFPHLSVLDNVRFGLTALSGEAQRKRALE
TLGQVGMAGYADSFPHHLSGGQQQRVALARALAPNPAVLLLDEPFSGLDARLREQVRDET
LHVLKQNGAATMLVTHDPEEAMFLADRIALMRAGKVVQVGNPVDLYTRPVNAFAAEFFGE
VNRLSGVVQGGAVDTPVGPIPTEVADGTAVDVLIRPEALKLSAQPAATVPAGDLPVLARV
MAARLLGRTSLVHLDVPDGKGGSVHLHSRMPGQFLPPEQSHVSVCMDLCQAFVFPAGAPT