Protein Info for AZOBR_RS14600 in Azospirillum brasilense Sp245

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 10 to 84 (75 residues), 61.2 bits, E=2.9e-20
• PF13417: GST_N_3
  • amino acids 15 to 86 (72 residues), 45.6 bits, E=2.1e-15
• PF13409: GST_N_2
  • amino acids 22 to 84 (63 residues), 44.7 bits, E=5e-15
• PF00043: GST_C
  • amino acids 112 to 197 (86 residues), 45.4 bits, E=2.3e-15
• PF13410: GST_C_2
  • amino acids 135 to 192 (58 residues), 36.6 bits, E=1.2e-12
• PF14497: GST_C_3
  • amino acids 136 to 198 (63 residues), 29.6 bits, E=2e-10

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 74% identity to azl:AZL_a02570)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See G8AQ62 at UniProt or InterPro

Protein Sequence (212 amino acids)

>AZOBR_RS14600 glutathione S-transferase (Azospirillum brasilense Sp245)
MEGSSTVSAEFTVYGNLNSQPATRVVLFLSMAGVPYAYRHVDLRGGQQKSADYLAINRFG
RVPTLVHGDLSISESGVILTYLAEKTGRFGGRDEAERIRLAEWLSWLADVLLPVQRARAV
RKFNGDANALPWIDAAAASGLAQFDRHLAGRTFIEGERLSIADIFAFPWIDLVEEANIDI
ATYPNVQAWHARVLAQPGAKRQMALMPQTDVG