Protein Info for AZOBR_RS14525 in Azospirillum brasilense Sp245

Annotation: formate hydrogenlyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 3 to 297 (295 residues), 127.9 bits, E=2.6e-41

Best Hits

Swiss-Prot: 37% identical to HYCD_ECOLI: Formate hydrogenlyase subunit 4 (hycD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 70% identity to rle:pRL110296)

MetaCyc: 37% identical to hydrogenase 3 membrane subunit HycD (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 4" in subsystem Formate hydrogenase

MetaCyc Pathways

• mixed acid fermentation (13/16 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production V (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

See G8AQ45 at UniProt or InterPro

Protein Sequence (305 amino acids)

>AZOBR_RS14525 formate hydrogenlyase (Azospirillum brasilense Sp245)
MLLVLALAPLLTGWVRLVKARLVGRRGPSMAQPYRDLLRLLRKEVVLARNASWLFRAVPY
MMFTAIWLAAGLVPVFTTQLALAPTADLIALIALLGSARFFLALAGMDTGTSFGGIGSSR
EMMIAALAEPAMLMIVFSVAILVRSTSLAEIADFMLSGAVGLRISLALALIALVMVAIAE
NARIPIDNPATHLELTMVHEAMVLEYSGRHLALVEAASMLKMLLYMALIACVFAPWGMAT
AGSGVAAALGGVAVFVAKLAVGGTLLALFETSIAKMRVFRVGEFLGGALLLSLLGAIFLY
VSRGV