Protein Info for AZOBR_RS14060 in Azospirillum brasilense Sp245

Annotation: malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01763: malate dehydrogenase, NAD-dependent
  • amino acids 3 to 311 (309 residues), 436.1 bits, E=3.3e-135
• PF00056: Ldh_1_N
  • amino acids 5 to 143 (139 residues), 150.1 bits, E=4.5e-48
• PF02866: Ldh_1_C
  • amino acids 148 to 314 (167 residues), 125 bits, E=3.3e-40

Best Hits

Swiss-Prot: 79% identical to MDH_PARL1: Malate dehydrogenase (mdh) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 92% identity to azl:AZL_025750)

MetaCyc: 74% identical to malate dehydrogenase subunit (Methylorubrum extorquens AM1)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (8/8 steps found)
• TCA cycle III (animals) (9/10 steps found)
• superpathway of vanillin and vanillate degradation (9/10 steps found)
• glyoxylate cycle (6/6 steps found)
• methylgallate degradation (6/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• mixed acid fermentation (13/16 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (6/7 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
• gluconeogenesis I (9/13 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• syringate degradation (8/12 steps found)
• chitin deacetylation (2/4 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• L-carnitine degradation II (1/3 steps found)
• reductive TCA cycle II (7/12 steps found)
• methylaspartate cycle (11/19 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (5/11 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Sequence Analysis Tools

See G8AHT2 at UniProt or InterPro

Protein Sequence (322 amino acids)

>AZOBR_RS14060 malate dehydrogenase (Azospirillum brasilense Sp245)
MARKKIALVGAGQIGGTLALLAAQKELGDVVLFDIAEGMPEGKALDLAETSPVEGFNAKL
SGGNDYSVIEGADVVIVTAGVPRKPGMSRDDLIGINTGVCQTVGENIKKYAPNAFVIVIT
NPLDVMVWVLQQASGLPPERVVGMAGVLDSARFRYFLADEFKVSVEDVTAFVLGGHGDTM
VPLVRYSTVAGIPLPDLVKMGWTTQEKLDAIVQRTRDGGAEIVKLLKTGSAFYAPAASAI
QMAESYLKDQKRVVPVAAYLTGQYGQNDLYVGVPTIIGAGGVEKIIEIDLSAEEKKMFDH
SVDAVKQLVEVVKKQQAEKAAS