Protein Info for AZOBR_RS14010 in Azospirillum brasilense Sp245

Annotation: homoserine O-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR01001: homoserine O-succinyltransferase" amino acids 1 to 300 (300 residues), 345.7 bits, see alignment E=1.4e-107 PF04204: HTS" amino acids 2 to 298 (297 residues), 414 bits, see alignment E=1.5e-128

Best Hits

Swiss-Prot: 70% identical to METAA_SPHWW: Homoserine O-acetyltransferase (metAA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00651, homoserine O-succinyltransferase [EC: 2.3.1.46] (inferred from 70% identity to swi:Swit_0586)

MetaCyc: 57% identical to homoserine O-acetyltransferase (Agrobacterium fabrum C58)
Homoserine O-acetyltransferase. [EC: 2.3.1.31]

Predicted SEED Role

"Homoserine O-succinyltransferase (EC 2.3.1.46)" in subsystem Methionine Biosynthesis (EC 2.3.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31 or 2.3.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AHR8 at UniProt or InterPro

Protein Sequence (307 amino acids)

>AZOBR_RS14010 homoserine O-succinyltransferase (Azospirillum brasilense Sp245)
MPIRIPNDLPAFTALQTEGVMVMQEADAIRQDIRPLRFGLLNLMPDKIRTETQIARLLGN
TPLQVELSLIRITNHVPRNTAADHMSAFYRSWEDARRETFDGFIITGAPVETMPFEEVSY
WDELCSVFDWTQSHVHACLNICWAAQAAVHHFHGVPKHLLPRKASGVFRHRNRAPASPYL
CGLSDGVPIPVSRWTEVREDDLPPESGLRVLLDSPETGPCLLEDAAHRSLHMFNHIEYDT
DTLRNEYVRDVAKDAATPVPHGYFPDDDPSQPPENRWRSHAHLLFANWINQIYQTTPFEL
SRIGTAA