Protein Info for AZOBR_RS13980 in Azospirillum brasilense Sp245

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00583: Acetyltransf_1" amino acids 46 to 121 (76 residues), 44.5 bits, see alignment E=3.4e-15 PF13673: Acetyltransf_10" amino acids 48 to 128 (81 residues), 54.2 bits, see alignment E=3.1e-18 PF13508: Acetyltransf_7" amino acids 51 to 123 (73 residues), 50.3 bits, see alignment E=5.3e-17 PF08445: FR47" amino acids 69 to 124 (56 residues), 27.2 bits, see alignment E=6.3e-10

Best Hits

Swiss-Prot: 51% identical to YJAB_ECOLI: Peptidyl-lysine N-acetyltransferase YjaB (yjaB) from Escherichia coli (strain K12)

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 51% identity to ppf:Pput_3670)

MetaCyc: 51% identical to peptidyl-lysine N-acetyltransferase YjaB (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AHR0 at UniProt or InterPro

Protein Sequence (154 amino acids)

>AZOBR_RS13980 GNAT family acetyltransferase (Azospirillum brasilense Sp245)
IPIRSSRPDDVPALFAVWLAAVRSTHDFLSEEDIGFYADLVRDQYLPAAALMVAVDGDDR
PVGFLGMTGSKIDTLFVDPAWHGRGIGRTLVARALEGGPELTVDVNEQNSAARAFYRRLG
FREVGRSALDDSGRPFPLLHLALDGASQGNPTGA