Protein Info for AZOBR_RS11115 in Azospirillum brasilense Sp245

Annotation: flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 214 to 242 (29 residues), see Phobius details PF01311: Bac_export_1" amino acids 13 to 246 (234 residues), 192.4 bits, see alignment E=4.5e-61 TIGR01400: flagellar biosynthetic protein FliR" amino acids 13 to 249 (237 residues), 177.6 bits, see alignment E=1.7e-56

Best Hits

Swiss-Prot: 39% identical to FLIR_CAUVC: Flagellar biosynthetic protein FliR (fliR) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 78% identity to azl:AZL_012100)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANE8 at UniProt or InterPro

Protein Sequence (256 amino acids)

>AZOBR_RS11115 flagellar biosynthesis protein FliR (Azospirillum brasilense Sp245)
MNLLQQFLGDQIFLWLLVFARVGTAFSIMPTIGDAFVSTRTRLLFSVAVSVLVAPVLGDR
MPPMPDNIFRLFVLIAGEVTVGIFMGTVARLLMGALEVAGTIIALQSGLSNAQMFNPAMA
SQGSLPGALMGWLGLLLIFITNLHHLLIMAVVDSYSTFAPGAAIPIDDMANVVGQLVGKS
FMLGVQMAAPFLISGMLFALALGLLNKLAPQIQVFFLFTSLQVALGLFMFALTLAAMMMF
WLTHFEAAFVDFLRPG