Protein Info for AZOBR_RS11105 in Azospirillum brasilense Sp245

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 841 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details PF00989: PAS" amino acids 95 to 190 (96 residues), 26.9 bits, see alignment E=1.7e-09 amino acids 341 to 409 (69 residues), 25 bits, see alignment E=6.4e-09 TIGR00229: PAS domain S-box protein" amino acids 211 to 335 (125 residues), 30.1 bits, see alignment E=2.2e-11 amino acids 338 to 460 (123 residues), 43.3 bits, see alignment E=1.9e-15 PF13426: PAS_9" amino acids 224 to 326 (103 residues), 28.4 bits, see alignment E=6.6e-10 amino acids 350 to 433 (84 residues), 21 bits, see alignment E=1.3e-07 PF13188: PAS_8" amino acids 340 to 389 (50 residues), 28.8 bits, see alignment 3.5e-10 PF08448: PAS_4" amino acids 346 to 455 (110 residues), 38.5 bits, see alignment E=4.7e-13 PF00512: HisKA" amino acids 471 to 533 (63 residues), 37.2 bits, see alignment 1e-12 PF02518: HATPase_c" amino acids 577 to 697 (121 residues), 88.9 bits, see alignment E=1.2e-28 PF00072: Response_reg" amino acids 723 to 833 (111 residues), 72.8 bits, see alignment E=1e-23

Best Hits

KEGG orthology group: K13587, two-component system, cell cycle sensor histidine kinase and response regulator CckA [EC: 2.7.13.3] (inferred from 76% identity to azl:AZL_012120)

Predicted SEED Role

"sensory box histidine kinase/response regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANE6 at UniProt or InterPro

Protein Sequence (841 amino acids)

>AZOBR_RS11105 histidine kinase (Azospirillum brasilense Sp245)
VDDTTSSFADSAPAGHRPDGAAGVGERPGGGFATAVLAALLLAGLVAAGAGVVLDRDPVA
WAGLTTAGAGALALAIRMVRARRRVARVGSLLGSALEGLPSGQLVCDGAGHVVFVNSTFR
SLTGWSEGEPPLRALERQFADDADSADAFRRLCERVKGGYSGSIELAVRQQGRAAEWRRI
QGQPIDGHAGAVMWRVEDITARRELEQVTRREQTQLVDFMDHAPIGFFSVDQDGHFQFVN
ATLAKWLGCAPEDLVEGGRRLHDVLAHPPASSAPYDLLEGGGLEQRGEIAMDGLQGRRFQ
AYVAQSVVRGEDGRISHTRSVVRDLTPEREWQEALRLSEQRFQRFFEDAPIGIALVDEVG
RLAECNQAFLALIGSEAGNVLGRGMADLIVPAERAMVTERLTAVQGGSDPAAPLEVRLTG
GRELVAQLYARRLGGVGPEGAAGLILHFIDMTERKGLEAQFAQSQKMQAVGQLAGGVAHD
FNNLLTAMIGFCDLLLLRHKPGDQSFSDIMQIKQNANRAANLVRQLLAFSRQQTLQPRIL
SVTDVLAELGNLMRRLIGENIELKMLHGRDIGYVKVDQNQLEQVIINLVVNARDAMAGGG
RLTIVTSNHVVEQAQRREHETIPAGDYVSIEVIDTGCGIPKENLQRIFEPFFTTKGVGSG
TGLGLSTVYGIVRQTGGFVLVESEKGEGTTFTILLPRHKGEARPDQGEPRERRGSDLTGS
GTIMLVEDEDAVRVFSARALRNKGYQVLEAKNGEAALQQIGTDGSRIDLLITDVVMPQMD
GPTLARHVRQVRPDMRVIFISGYAEDRLGEIDGVEVAHFLPKPFSLKQLASKVKEVIRDG
K