Protein Info for AZOBR_RS11065 in Azospirillum brasilense Sp245

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details PF20617: DUF6803" amino acids 1 to 157 (157 residues), 249.5 bits, see alignment E=8.6e-79

Best Hits

KEGG orthology group: None (inferred from 78% identity to rru:Rru_A1696)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AND6 at UniProt or InterPro

Protein Sequence (165 amino acids)

>AZOBR_RS11065 permease (Azospirillum brasilense Sp245)
MTMTHYMELLAVNQPWNLLIFMAIPVILAETVAISELYLLYTRDYDGPVRRLNRWAGITV
GVYFTGVFIHLIQNAVVPLTVSGGWRGPADVLAVGFYLAGIVPLGGIALLDLGLIGRGRG
EQGRMAIHAALVGLFLIVAHIAMIFGMLDPTLLTGAAAAGGHTMH