Protein Info for AZOBR_RS11060 in Azospirillum brasilense Sp245

Annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 41 to 58 (18 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 36 to 486 (451 residues), 507.3 bits, see alignment E=1.9e-156 PF12801: Fer4_5" amino acids 97 to 137 (41 residues), 40.1 bits, see alignment 1.2e-13 PF13746: Fer4_18" amino acids 219 to 326 (108 residues), 128.3 bits, see alignment E=6.4e-41 PF11614: FixG_C" amino acids 363 to 488 (126 residues), 105.9 bits, see alignment E=6.3e-34

Best Hits

KEGG orthology group: None (inferred from 72% identity to azl:AZL_016980)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AND5 at UniProt or InterPro

Protein Sequence (488 amino acids)

>AZOBR_RS11060 (Fe-S)-binding protein (Azospirillum brasilense Sp245)
MSLSSPAPAAHDADQPRERWFVHRPKVYAADVHGRFRRLKWLALAVLLGVYYVTPWLRWD
RGPGIPDQAVLVDMVGRRAYFFWIEIWPQEVYYLTGLLIIGAFGIFFATTLLGRIWCGYA
CPQTVWTDLFMWVERKLEGPRTERIRLDKAPLSARKLGLKASKHAIWLMISLVTGGAWIF
YFNDAPTLLREIATGEVSWKVLAFAGLFTATTYFFAGWAREQICIYVCPWRSFQAAMVDE
DTYVVTYQDWRGEGRAPLRKTQSWEERTAEGLGDCIDCKLCVHVCPTGTDIRKGQQISCI
GCGLCVDACNDVMAQVGRPGDLILFDTRSNQVARADGQAAPVRLLRPRTVIYALIILVVA
GAMAISLALRPTLDVSVLRDRAPLYVQQSNGDVQNAYTIKILNKTHEARTYRLSVEGLAN
ADLSVASVDAQSGSSLTLAAEADSVATYRIFVRVPRGAATPGSTDVTVLARDLTSGEIGR
HRSVFMAP