Protein Info for AZOBR_RS10520 in Azospirillum brasilense Sp245

Annotation: copper-resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 287 to 311 (25 residues), see Phobius details amino acids 331 to 354 (24 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 415 to 441 (27 residues), see Phobius details amino acids 448 to 469 (22 residues), see Phobius details amino acids 489 to 507 (19 residues), see Phobius details amino acids 513 to 531 (19 residues), see Phobius details amino acids 541 to 560 (20 residues), see Phobius details PF11412: DsbD_N" amino acids 50 to 151 (102 residues), 65.1 bits, see alignment E=6.1e-22 PF13899: Thioredoxin_7" amino acids 582 to 664 (83 residues), 46 bits, see alignment E=5e-16

Best Hits

KEGG orthology group: None (inferred from 72% identity to azl:AZL_015410)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AN13 at UniProt or InterPro

Protein Sequence (694 amino acids)

>AZOBR_RS10520 copper-resistance protein (Azospirillum brasilense Sp245)
MKRFVPFLLAILALAAPGMGRAETGSWVKSGPVEARLVASVQGVGDLAKIPLGLEVRLEP
GWKTYWRTPGDAGFAPRLDWSESRNLKATELIYPAPHRFTVLGFETAGYDAEVLFPIAAT
PAEPGKPLDLALKAELLVCSTICVPEMVALSLSIPEGPATPGASANDIARAQSLVPGDGR
ASGLTVTAVRGQGAVLEVEVTAREPMVAPDVFVETDPPVTFAAPKSQFLDGDRRAILRMD
ATDPTPGLDLAGRAMTLTVVDGNRSVEAPATAAAGLGGGAGAAPAGLLAMLGVALLGGLI
LNLMPCVLPVLSLKLLSIVQHGGRAPAAVRAGFLASAAGILTSFLILAGALVAVKAAGGA
VGWGIQFQQPLFLVFMVVLVTLFAANLWGLFELPLPRAVADRLGGPEGQGLGGQFATGAF
ATLLATPCSAPFLGTAVGFALSRGAPEVFAIFAALGVGLALPYLLIAAFPRAARLLPRPG
RWMVALRRVLGGALALTALWLLSVLVVQVGEVPALAVAVLMGGLVAALWLGRRLAETARW
AGAALAGLLALVAFAVPAVFGPSAGAAPVAESTAARWTVFDEAAIREQVAVGRTVFVDVT
ADWCITCQANKKLVLNRGTVAQRLEDAGTVTAMRADWTRPDESIARYLARHGRYGIPFNI
VYGPGAPDGIALPELLTEGAVLDALDRASGKIKS