Protein Info for AZOBR_RS10465 in Azospirillum brasilense Sp245

Annotation: glycine cleavage system protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 121 (119 residues), 143.7 bits, E=1.6e-46
• PF01597: GCV_H
  • amino acids 4 to 121 (118 residues), 143.5 bits, E=1.5e-46

Best Hits

Swiss-Prot: 66% identical to GCSH_PARL1: Glycine cleavage system H protein (gcvH) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 76% identity to azl:AZL_015870)

MetaCyc: 51% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See G8AN00 at UniProt or InterPro

Protein Sequence (124 amino acids)

>AZOBR_RS10465 glycine cleavage system protein H (Azospirillum brasilense Sp245)
MTIKYTKDHEWVRVEGDVGTVGVSDHAQHQLGDVVFVELPDVGRQLAQGKEAAVVESVKA
ASDVFAPVSGEVIEANADLENDPSLVNAGAETTGWFFKLRLSNPSELDGLMDEAAYKAFV
EGQA