Protein Info for AZOBR_RS10450 in Azospirillum brasilense Sp245

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details PF00691: OmpA" amino acids 325 to 430 (106 residues), 62.4 bits, see alignment E=2.1e-21

Best Hits

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AMZ7 at UniProt or InterPro

Protein Sequence (439 amino acids)

>AZOBR_RS10450 chemotaxis protein (Azospirillum brasilense Sp245)
MPSISRRNGHREASAWPGWVDALSSLVMVVIFLLMIFVVAQFYMATALTGRDEQLGSLNR
KVAELNDLLALERDANADLRINVAQLSAELQGSVAARDTMTGRIATLQGDLDHATRAAEE
LQRTIRADKETIELKLAEAASLQADLKALREARTKLEGELAAAAAQQRLTEEQRQALLAE
LGGERDRSKALETRLASADEKTMLAQKDIEKRDIRITELMTSLSAEQGATGKANEQVDLL
NRQMAALREQLARIGAVLEISEKKAEEQQVQIAELGSRLNQALAAKVQDLARYRSEFFGR
VREALGNRPDVRIVGDRFVFQSELLFPSGSATLEEAGKQRLAELARTLIEIGRTIPPDIN
WVLRVDGHTDARPVRIQFASNWELSAARAISVVKYLIDQGIPAGRLAAAGFGEYQPLDPG
TSDDALARNRRIEVKLDQR