Protein Info for AZOBR_RS10110 in Azospirillum brasilense Sp245

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 240 to 272 (33 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 317 to 342 (26 residues), see Phobius details amino acids 348 to 374 (27 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 398 (384 residues), 213.8 bits, see alignment E=3.7e-67 PF00027: cNMP_binding" amino acids 478 to 557 (80 residues), 64.3 bits, see alignment E=8.2e-22

Best Hits

KEGG orthology group: None (inferred from 65% identity to ara:Arad_8679)

Predicted SEED Role

"TrkA-N:Sodium/hydrogen exchanger" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AMR6 at UniProt or InterPro

Protein Sequence (592 amino acids)

>AZOBR_RS10110 cation transporter (Azospirillum brasilense Sp245)
MSHDVPLISMIAIAFGLAFIFGYLADRIRLPPLVGYLVAGVIIGPFTPGFVADGALAAQL
AEIGVILLMFGVGLHFSPSDLLAVRKIAIPGAVGQIGLATALGVGLAWLWGWSLGAGLVL
GLSLSVASTVVLLKALEERDMLNTAEGRVAVGWLIVEDLAMVLALVLLPALAEVLGGHAP
GTTGGAAGGHGAGSDGPIWLTLALTLGKVAAFSVLAIVLGPRVVPVILTNVARTGSRELF
TLSVLAIALGVAYGSAVLFGVSFALGAFFAGVVLNESRFSHKAATDSMPLQDAFAVLFFV
SVGMLFDPSILLRDPLAVIAVVALIVVGKSLIAFGIVILLRFPVGMGLAVSASLAQIGEF
SFILVGLGMSLGLLPEEGRDLVLAGALLSITLNPAVFAAVAALRKHLQAKRAAGVPPYGW
EQFEQLQSSLADARHQAEEREKEHDLQIQALAKTFPVLSLLDAHEQERLMMLFRPKSAVP
GERIIRKGDRANAMYFIASGAVEVLMEGQTIRLGAGTMFGEMALLSGQRRNADVAAVDYC
QFQVLERRDFNQFTARHPALRTALIDMAAQRRKMNQQDAATDEAVAASESAA