Protein Info for AZOBR_RS09410 in Azospirillum brasilense Sp245

Annotation: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF08659: KR" amino acids 9 to 185 (177 residues), 44.5 bits, see alignment E=2.6e-15 PF00106: adh_short" amino acids 9 to 198 (190 residues), 201.8 bits, see alignment E=1.2e-63 PF13561: adh_short_C2" amino acids 14 to 247 (234 residues), 203.8 bits, see alignment E=4.7e-64

Best Hits

Swiss-Prot: 38% identical to TSAC_COMTE: 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 (tsaC1) from Comamonas testosteroni

KEGG orthology group: None (inferred from 69% identity to azl:AZL_b02320)

MetaCyc: 57% identical to 4-oxopentanoyl-CoA 4-dehydrogenase (Pseudomonas putida KT2440)
1.1.1.M44 [EC: 1.1.1.M44]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.M44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AMA5 at UniProt or InterPro

Protein Sequence (253 amino acids)

>AZOBR_RS09410 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (Azospirillum brasilense Sp245)
MTFPLTNRTALVTGASAGLGRHFAGVLAAAGARVALAARRRESLDAAVAEIEAAGGQAIA
VPLDVTDAASVRNGVREAAGALGGLDILVNNAGATVAKPALDYAEEEWDRVIDTNLKGAF
LTAQETARVMREQGRGGSIVNIASILGLRVAGHVVAYTASKAGLVQMTQAVALEWARYGI
RVNALAPGYMETDLNRDFLATDAGQALIRRVPQRRLGRLADLDGPLLLLCSDASAYMTGA
VVPVDGGHLVSTL