Protein Info for AZOBR_RS08955 in Azospirillum brasilense Sp245

Annotation: molybdopterin-guanine dinucleotide biosynthesis protein MobB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 TIGR00176: molybdopterin-guanine dinucleotide biosynthesis protein B" amino acids 4 to 161 (158 residues), 158.4 bits, see alignment E=7.3e-51 PF03205: MobB" amino acids 4 to 136 (133 residues), 179.2 bits, see alignment E=1.8e-57

Best Hits

KEGG orthology group: K03753, molybdopterin-guanine dinucleotide biosynthesis protein B (inferred from 76% identity to azl:AZL_015470)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AM00 at UniProt or InterPro

Protein Sequence (175 amino acids)

>AZOBR_RS08955 molybdopterin-guanine dinucleotide biosynthesis protein MobB (Azospirillum brasilense Sp245)
MKMFGLTGWSGSGKTTLIVRLIPALIRRGLTVSTMKHAHKGFDIDHPGKDSHNHREAGAT
EVLVSSPRRWALMHEIRNDEPELSLAELLPKLSPVDLLLIEGFKREPHEKIEVWRASVGK
SLIARDDPSIVAIASDGPVPDAGVPVFDLNDEEAIASFIIERCALDRCRATGQAV