Protein Info for AZOBR_RS08950 in Azospirillum brasilense Sp245

Annotation: molybdopterin biosynthesis protein MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 309 to 324 (16 residues), see Phobius details PF03453: MoeA_N" amino acids 17 to 178 (162 residues), 159.4 bits, see alignment E=8.9e-51 PF00994: MoCF_biosynth" amino acids 191 to 332 (142 residues), 104.7 bits, see alignment E=5.5e-34 PF03454: MoeA_C" amino acids 347 to 418 (72 residues), 57 bits, see alignment E=2.7e-19

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 70% identity to azl:AZL_015450)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALZ9 at UniProt or InterPro

Protein Sequence (422 amino acids)

>AZOBR_RS08950 molybdopterin biosynthesis protein MoeA (Azospirillum brasilense Sp245)
MAQLSDDCFAFGGEMMAVDRALELLSGRLHPVTETHRIGLADALGHVLAEDVVAPFNVPP
HDNSAVDGYAVFFDDLTPDAATLLPVTARVAAGHALDRPGRRGEAVRIFTGAPMPEGFDT
VLMQEDCKAGEGTVVIPPGIRRGANRRRAGEDMAQGSTVLTAGRRLRAEDIGLLASLGRR
EVTVRTALRVAVFSTGDEVREPGVPLEPGCIYDANRFALIAALCQLGCGVTDLGILPDRL
DAVRGALEAAAGTHDVLITSGGMSTGEEDHVKAAVEALGGLHFWRLAIKPGRPVALGTVK
GATKGAAVFVGLPGNPVAVMVTFLRIARPILLRLMGAADEAPALFPLRAGFTYKKKAGRR
EYVRATLARAADGVLTAVKHPRDGAGILSSMVESDGLVELPEEITRVEPGMIVDFLPFSE
VR