Protein Info for AZOBR_RS08905 in Azospirillum brasilense Sp245

Annotation: RNA polymerase sigma 70

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR02392: alternative sigma factor RpoH" amino acids 12 to 281 (270 residues), 332.8 bits, see alignment E=1.8e-103 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 45 to 279 (235 residues), 98 bits, see alignment E=4.6e-32 PF04542: Sigma70_r2" amino acids 50 to 115 (66 residues), 68.3 bits, see alignment E=4e-23 PF04545: Sigma70_r4" amino acids 227 to 278 (52 residues), 47.5 bits, see alignment 1e-16

Best Hits

Swiss-Prot: 59% identical to RPOH_CAUVN: RNA polymerase sigma factor RpoH (rpoH) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: None (inferred from 88% identity to azl:AZL_015730)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALY9 at UniProt or InterPro

Protein Sequence (296 amino acids)

>AZOBR_RS08905 RNA polymerase sigma 70 (Azospirillum brasilense Sp245)
VLKKLLTGENASLTRYVEESKRFPILAPDEERELAVAWRDRGNGHALERLVGSHLRLVIK
IARGFGGYGLPLVDLVAEGNVGLMQAAQKFDPGRGFRFATYATWWIRAAIQEYILHSWSL
VKMGTTAAQKKLFFNLRRLKSQMQELEQGDLSPSTVTAIATELDVPEQEVIEMNRRLSSN
DSSLDAALSSDGETNWLELLADDRPTQESVIAEADELALRRRLVGQALERLDDRERRILF
ERRLKEDPSTLESLSQQFCVSRERVRQIEVRAFEKLQKAVLSAAQALRRAPAHMAA